General description
Epithelial membrane protein-3 (EMP3) belongs to the belongs to the peripheral myelin protein 22 kDa (PMP22) gene family of small hydrophobic membrane glycoproteins. This gene is located on human chromosome 19q13.3. EMP3 codes for a 163 amino-acid protein that has four transmembrane domains.
Immunogen
EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Biochem/physiol Actions
Epithelial membrane protein 3 (EMP3) is a trans-membrane signaling molecule that controls apoptosis, differentiation and invasion of cancer cells. This gene may be considered as a tumor suppressor gene in glioma, neuroblastoma, esophageal squamous cell carcinoma (ESCC) cell lines and non-small cell lung cancer (NSCLC).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51112007
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0002014M1-100UG
- Temperature Control Device:
- Yes