General description
Frataxin (FXN) protein consists of α/β fold, which is followed by the C-terminal region (CTR), with a nonperiodic structure.The gene is located on human chromosome 9q21.11.
Immunogen
FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Biochem/physiol Actions
Frataxin (FXN) is involved in the activation of iron-sulfur cluster assembly.Overexpression of FXN in reticulocytes is associated with oxidative stress and iron status.Deficiency of FXN in human astrocytes is linked to cell death and release of neurotoxins.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 41106508
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0002395M3-100UG
- Temperature Control Device:
- Yes