General description
G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) is a constituent of stress granules. It is located on human chromosome 5q14.2-5q33.3.
Immunogen
G3BP (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV
Biochem/physiol Actions
G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) blocks the replication of HIV-1 (human immunodeficiency virus) in macrophages and T-cells. In gastric cancer patients, overexpression of G3BP1 leads to imperfect clinical predictions. It is crucial for the interactions of SG–PB (stress granule-processing bodies).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- WH0010146M1-100UG
- Product Size:
- 100/µG
