General description
G protein-coupled receptor 5D (GPRC5D), a surface receptor consists of seven putative transmembrane segments. It is expressed in the cell membrane. This protein belongs to the retinoic acid inducible gene 1 or retinoic acid inducible GPCR 1 (RAIG1) family. GPRC5D is located on human chromosome 12p13.
Immunogen
GPRC5D (NP_061124, 261 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
Biochem/physiol Actions
G protein-coupled receptor 5D (GPRC5D) considered as an important marker for monitoring the tumor load and also to target multiple myeloma cells. Overexpression of GPRC5D affects the expression of hard keratins and also decrease the metabolic activities of hair bulb cells (HBCs).
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- WH0055507M1-100UG
- Product Size:
- 100/µG
