General description
Hyaluronan and proteoglycan link protein 4 (HAPLN4) is expressed in the brain.
Immunogen
HAPLN4 (NP_075378, 30 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT
Biochem/physiol Actions
Hyaluronan and proteoglycan link protein 4 (HAPLN4) takes part in the development of the extracellular matrix. It also has a role in adhesion and migration of glioma cells. HAPLN4 aids in the association of hyaluronan with other proteins like aggrecan.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0404037M2-100UG
- Temperature Control Device:
- Yes
