General description
The gene INSRR (insulin receptor related receptor) is mapped to human chromosome 1q21-q23. It belongs to the insulin receptor family of proteins. INSRR is mainly present in organs which are associated with acid/base generation. The protein has two N-terminal leucine-rich repeat domains, a cysteine-rich C domain and three C-terminal fibronectin type-III repeats.
Immunogen
INSRR (NP_055030, 651 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
Biochem/physiol Actions
INSRR (insulin receptor related receptor) exhibits pH-sensing property and is a sensor for mild alkaline extracellular medium. In mice, it is associated with excessive excretion of base by the kidneys.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51183609
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1409253-100UG
- Temperature Control Device:
- Yes