General description

Kruppel like factor 2 (KLF2) is a tumor-suppressor gene, localized on human chromosome 19p13.11.

Immunogen

KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

Biochem/physiol Actions

Kruppel like factor 2 (KLF2) is crucial for lung functioning, cell differentiation, migration and tissue development. It modulates endothelial pro-inflammatory activation. The protein has roles in cardiovascular development and T-cell differentiation. Mutation in the gene encoding it has been associated with heritable pulmonary arterial hypertension.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.