General description
Keratin 1 (KRT1) is a cytoplasmic intermediate filament protein, that is expressed in the basal layer of the epidermis. This gene is located on human chromosome 12q13.
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. (provided by RefSeq)
Immunogen
KRT1 (NP_006112, 387 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE
Biochem/physiol Actions
Keratin 1 (KRT1) helps to maintain skin integrity and participates in inflammatory response. It plays an important role in the differentiation and function of keratinocytes. Since KRT1 is one of the important cytoskeleton filament, it extends mechanical support and participates in additional activities in epithelial cells.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51313432
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0003848M1-100UG
- Temperature Control Device:
- Yes
