General description
Kinase suppressor of ras 2 (KSR2) is a scaffolding protein.
Immunogen
KSR2 (NP_775869, 411 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV
Biochem/physiol Actions
Kinase suppressor of ras 2 (KSR2) has a role in the growth and proliferation of breast tumor cells. It takes part in signaling pathways and associates with calcineurin.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 41106300
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0283455M1-50UG
- Temperature Control Device:
- Yes