General description
MYC associated zinc finger protein (MAZ) is also known as SAF-1 (serum amyloid A activating factor 1) and Pur-1 (purine binding factor-1). It is a member of the the family of Cys2-His2 type zinc fingers. This gene is mapped to human chromosome 16p11.
Immunogen
MAZ (NP_002374, 332 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ
Biochem/physiol Actions
MYC associated zinc finger protein (MAZ) controls various inflammation-responsive genes. It plays a major role in the development of AA amyloidosis (amyloid A amyloidosis), a consequence of chronic inflammation. MAZ controls transcriptional initiation and termination by binding to c-MYC and C2 gene sequences.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- WH0004150M1-100UG
- Product Size:
- 1/EA
