General description
Mixed-lineage leukemia 2 (MLL2), a histone methyltransferase that belongs to the trithorax group, is expressed ubiquitously in adult tissues. Structurally, MLL2 comprises plant homeodomain (PHD), Su(var)3-9, Enhancer-of-zeste and Trithorax (SET) domain, and a high mobility group (HMG) box. The MLL2 gene is mapped to human chromosome 12q13.12.
Immunogen
MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
Biochem/physiol Actions
Mixed-lineage leukemia 2 (MLL2) regulates the expression of homeobox (Hox) genes. Mutations or haploinsufficiency in the MML2 gene is implicated in Kabuki syndrome, a multi-systemic disorder. It carries out methylation on the lysine 4 of histone H3 (H3K4). MLL2 plays a tumor suppressor role in Merkel cell carcinoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51311810
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1402978-100UG
- Temperature Control Device:
- Yes
