Skip to main content

Monoclonal Anti-MMP9 antibody produced in mouse (C15-1318-551)

Catalog No.
C15-1318-551
Manufacturer No.
AMAB90804-100UL
Manufacturer Name
Sigma-Aldrich
Quantity
100
Unit of Measure
UL
Price: $977.14
List Price: $1,085.71

Immunogen Recombinant protein corresponding to matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase. Sequence

Enjoy exclusive benefits including discounted pricing on orders by contacting our Sales Executives to open an account.

Adding to cart… The item has been added

Immunogen

Recombinant protein corresponding to matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase.

Sequence

PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI

Epitope
Binds to an epitope located within the peptide sequence VPDLGRFQTF as determined by overlapping synthetic peptides.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST83039.

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source: mouse. Quality Level: 100. conjugate: unconjugated. antibody form: purified immunoglobulin. antibody product type: primary antibodies. clone: CL0538, monoclonal. product line: Prestige Antibodies®. Powered by Atlas Antibodies. form: buffered aqueous glycerol solution. species reactivity: human. packaging: antibody small pack of 25 . μ. L. technique(s): immunoblotting: 1 . μ. g/mL, immunohistochemistry: 1:500- 1:1000. isotype: IgG1. Ensembl | human accession no.: ENSG00000100985. UniProt accession no.: P14780. shipped in: wet ice. storage temp.: −. 20°C. target post-translational modification: unmodified. Gene Information: human ... MMP9(4318). Storage Class Code: 10 - Combustible liquids. WGK: WGK 1. Flash Point(F): Not applicable. Flash Point(C): Not applicable.
UPC:
12352203
Condition:
New
Weight:
1.00 Ounces
HazmatClass:
No
WeightUOM:
LB
MPN:
AMAB90804-100UL


Cenmed Satisfaction Guarantee

At Cenmed, your confidence and satisfaction are paramount. We guarantee the quality and reliability of our extensive range of clinical and laboratory supplies. If you're not completely satisfied with your purchase, we offer a straightforward return process and dedicated support to resolve your concerns promptly. Our commitment ensures that you can order with confidence, knowing that Cenmed is dedicated to superior service and customer satisfaction. Trust us to meet your needs with every order, backed by our promise of excellence. Learn more in Help & FAQs.


"Cenmed provides me access to the same products/services normally reserved for much larger labs than mine. I was presently surprised by their product offering."

LAB DIRECTOR


"We utilized Cenmed's capabilities for a variety of projects around the world. They are a valued partner and supplier."

PHARMACEUTICAL SUPPLY CHAIN LEADER


"The reps are very good at finding products for customers in this period of supply chain issues."

SCOTT BEHMAN


"Your customer service has been excellent and makes me excited about purchasing with Cenmed in the future!!"

PROCUREMENT + BILLING COORDINATOR AT PHARMA.