General description
Neural cell adhesion molecule (NCAM/CD56) is a calcium-independent binding protein. It is located on human chromosome 11q23.1. This molecule belongs to the immunoglobulin superfamily. NCAM1 is present in neurons and glial cells.
Immunogen
NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
Biochem/physiol Actions
Neural cell adhesion molecule (NCAM/CD56) participates in homophilic cell–cell and heterophilic cell–matrix interactions. It controls the movement of cells and condensation during skeletal development. This protein participates in synaptic plasticity, neurodevelopment and neurogenesis.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51422355
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0004684M1-100UG
- Temperature Control Device:
- Yes
