MONOCLONAL ANTI-NPAS2

Catalog No.: C005B-337544
Mfr. No.: SAB1404142-200UL
Mfr. Name: Sigma-Aldrich
Qty/UOM: 1
UOM: EA

Price: $980.46

List Price: $1,089.40

General description The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory.

Enjoy exclusive benefits including discounted pricing on orders by contacting our Sales Executives to open an account. Contact Us

Current Stock:

Quantity:

Adding to cart… The item has been added

Description
Specifications

General description

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain. (provided by RefSeq)

Immunogen

NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH

Physical form

Clear solution

Shipping Information:

Dry Ice Surcharge & Ice Pack Shipments: $40

More Information: https://cenmed.com/shipping-returns

UPC:: 51182413
Condition:: New
Availability:: 3-5 Days
Weight:: 1.00 Ounces
HazmatClass:: No
MPN:: SAB1404142-200UL
Temperature Control Device:: Yes

Cenmed Satisfaction Guarantee

At Cenmed, your confidence and satisfaction are paramount. We guarantee the quality and reliability of our extensive range of clinical and laboratory supplies. If you're not completely satisfied with your purchase, we offer a straightforward return process and dedicated support to resolve your concerns promptly. Our commitment ensures that you can order with confidence, knowing that Cenmed is dedicated to superior service and customer satisfaction. Trust us to meet your needs with every order, backed by our promise of excellence. Learn more in Help & FAQs.

"Cenmed provides me access to the same products/services normally reserved for much larger labs than mine. I was presently surprised by their product offering."