General description
POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM
Immunogen
POU6F2 (NP_009183, 2 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51202412
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1404927-100UG
- Temperature Control Device:
- Yes
