General description
Member of RAS oncogene family, RAB15 is a GTPase expressed in the brain.
Immunogen
RAB15 (AAH40679, 99 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IMKWVSDVDEVGDATSLPGCGEGASPGKARRGPDGKANASRKLCLPQPWMKTSGTHQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHSRV
Biochem/physiol Actions
Member of RAS oncogene family, RAB15, has a role in endocytosis. It is a target of the protein atonal homolog 1 (Atoh1), a neural transcription factor. RAB15 has been linked to neuroblastoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
- UPC:
- 51202415
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- WH0376267M1-100UG
- Product Size:
- 100/µG
