General description
Miro1/RHOT1 (ras homolog family member T1) is an outer mitochondrial membrane (OMM) protein. It has a transmembrane domain, two GTPase domains and two Ca2+-sensing EF-hand domains. RHOT1 is located on human chromosome 17q11.
Immunogen
ras homolog family member T1, recombinant protein epitope signature tag (PrEST)
Sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
Epitope
Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.
Application
Monoclonal Anti-RHOT1 antibody has been used in Immunoprecipitation.
Biochem/physiol Actions
Miro1/RHOT1 (ras homolog family member T1) regulates mitochondrial trafficking and distribution. The Rho GTPase Miro-1 plays a crucial role in the modulation of mitochondrial morphogenesis and acts as a calcium-dependent sensor for the control of mitochondrial motility.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST71907.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
biological source: mouse. Quality Level: 100. conjugate: unconjugated. antibody form: purified immunoglobulin. antibody product type: primary antibodies. clone: CL1095, monoclonal. product line: Prestige Antibodies®. Powered by Atlas Antibodies. form: buffered aqueous glycerol solution. species reactivity: human. packaging: antibody small pack of 25 . μ. L. technique(s): immunohistochemistry: 1:200- 1:500. isotype: IgG1. Ensembl | human accession no.: ENSG00000126858. UniProt accession no.: Q8IXI2. shipped in: wet ice. storage temp.: −. 20°C. target post-translational modification: unmodified. Gene Information: human ... RHOT1(55288). Storage Class Code: 10 - Combustible liquids. WGK: WGK 1. Flash Point(F): Not applicable. Flash Point(C): Not applicable.- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AMAB90854-100UL