General description
Ribonuclease H1 (RNASEH1) is an endonuclease which is expressed in the mitochondria and nucleus. It possesses two domains which aid in binding to nucleic acids. The gene encoding this protein is localized on human chromosome 2p25.
Immunogen
RNASEH1 (NP_002927, 189 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Biochem/physiol Actions
Ribonuclease H1 (RNASEH1) digests the RNA segment in a DNA-RNA hybrid. Mutations in the gene encoding it have been associated with chronic progressive external ophthalmoplegia.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 12352204
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0246243M1-100UG
- Temperature Control Device:
- Yes
