General description
This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)
Immunogen
RXRG (-, 1 a.a. ~ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG
Physical form
Clear solution
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51111654
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1404343-200UL
- Temperature Control Device:
- Yes