Immunogen
SH3RF2 (NP_660205, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK
Biochem/physiol Actions
SH3 domain containing ring finger 2 (SH3RF2) binds to protein phosphatase 1 in vitro. It is an anti-apoptotic protein which negatively regulates c-Jun N-terminal kinase (JNK) pathway and also associates with p21-activated kinase 4. SH3RF2 has been shown to be upregulated in cancers.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0153769M1-100UG
- Temperature Control Device:
- Yes
