General description
Anti-AURA Antibody detects endogenous levels of total AURA protein.
SOX10 (SRY-box 10) is a co-transcription factor that is located on human chromosome 22q13. SOX10 is temporarily expressed in melanoblasts.
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. (provided by RefSeq)
Immunogen
SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Biochem/physiol Actions
SOX10 (SRY-box 10) regulates the expression of ErbB3 in neural crest cells. It is required for differentiation of peripheral glia. SOX10 plays an important role in the progression of melanocytes. Mutations in SOX10 result in Waardenburg syndrome and Hirschsprung disease.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- SAB1402361-100UG
- Product Size:
- 100/µG
