General description
This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. (provided by RefSeq)
Immunogen
TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Biochem/physiol Actions
The gene TRIM16 (tripartite motif containing 16), also referred to as estrogen-responsive B box protein (EBBP), encodes a protein that has the ability to heterodimerize with other TRIM proteins and also has E3 ubiquitin ligase activity. It is found to positively regulate transcriptional regulator of the retinoic acid receptor β2 (RARβ2) gene. Overexpression of trim16 facilitates retinoid-induced differentiation, reduces neuroblastoma cell growth, migration, and considerably decreases tumorigenicity in vivo.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- WH0010626M1-100UG
- Product Size:
- 100/µG
