General description
Recombinant protein fragment of Human UNC45B with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Suitable as a blocking agent using corresponding antibodies.
Linkage
Corresponding Antibody HPA017861.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
recombinant: expressed in E. coli. Quality Level: 100. Assay: >. 80% (SDS-PAGE). form: buffered aqueous solution. mol wt: predicted mol wt 30 . kDa. purified by: immobilized metal affinity chromatography (IMAC). concentration: ≥. 0.5 . mg/mL. immunogen sequence: GEDDDKVQNAAAGALAMLTAAHKKLCLKMTQVTTQWLEILQRLCLHDQLSVQHRGLVIAYNLLAADAELAKKLVESELLEILTVVGKQEPDEKKAEVVQTARECLIKCMDYGFI. Ensembl | human accession no.: ENSG00000141161. UniProt accession no.: Q8IWX7. shipped in: wet ice. storage temp.: −. 20°C. Gene Information: human ... UNC45B(146862). Storage Class Code: 10 - Combustible liquids. WGK: WGK 2. Flash Point(F): Not applicable. Flash Point(C): Not applicable.- UPC:
- 41181913
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- APREST72666-100UL