General description
A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC50 = 0.9 nm) isolated from the Trinidad chevron tarantula. Psalmotoxin-1 (PcTx1) can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b. Binding site is blocked when dimerization with ASIC2a or ASIC3.
Biochem/physiol Actions
Primary Target
ASIC1a
Warning
Toxicity: Standard Handling (A)
Sequence
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (disulfide bond 3-18, 10-23, 17-33)
Other Notes
Qadri, Y. J. et al. 2009. J. Biol. Chem.284, 17625.
M. Mazzuca, et al. 2007. Nat Neurosci.10, 943.
Escoubas, P. et al. 2000. J. Biol. Chem.275, 25116.
Legal Information
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Molecular Weight: 4689.39. Empirical Formula: C200H312N62O57S6. Assay: ≥. 94% (HPLC). Quality Level: 100. form: semisolid, viscous liquid. potency: 0.9 . nM IC50. manufacturer/tradename: Calbiochem®. . storage condition: OK to freeze, desiccated (hygroscopic), protect from light. color: colorless. storage temp.: −. 20°C. Storage Class Code: 11 - Combustible Solids. WGK: WGK 3. Flash Point(F): Not applicable. Flash Point(C): Not applicable.- UPC:
- 51181608
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- 5085140001
