-
HPA051314-100UL
Sigma-Aldrich
Anti-C18orf25 antibody produced in rabbit (C15-1460-619)
Price: $928.29List Price: $1,031.43Immunogen chromosome 18 open reading frame 25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA065021-100UL
Sigma-Aldrich
Anti-C18orf25 antibody produced in rabbit (C15-1464-793)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 18 open reading frame 25 Sequence QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA014527-100UL
Sigma-Aldrich
Anti-C19orf18 antibody produced in rabbit (C15-1448-173)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C19orf18 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA079195-100UL
Sigma-Aldrich
ANTI-C19ORF18 ANTIBODY PRODUCED IN RABBIT (C15-1467-200)
Price: $977.14List Price: $1,085.71Immunogen chromosome 19 open reading frame 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA057806-100ULImmunogen chromosome 19 open reading frame 35 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA059965-100ULImmunogen chromosome 19 open reading frame 43 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA061028-100ULImmunogen chromosome 19 open reading frame 68 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA048654-100ULImmunogen chromosome 19 open reading frame 71 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA062719-100ULImmunogen chromosome 19 open reading frame 73 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA045225-100ULImmunogen chromosome 2 open reading frame 69 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA043759-100ULImmunogen chromosome 5 open reading frame 49 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
ABN1360
Sigma-Aldrich
Anti-C9ORF72 (alpha-GR sense Antibody, CT) (C15-1317-340)
Price: $759.43List Price: $843.81Expansion of a GGGGCC (G4C2) hexanucleotide repeat sequence in the non-coding region of human chromosome 9 open reading frame 72 or C9orf72 (also known as ALSFTD, FTDALS Gene ID 203228) is the most common genetic abnormality in familial and