Labeled Compounds

Immunogen Synthetic peptide directed towards the N terminal region of human NR1H3 Biochem/physiol Actions NR1H3 belongs to the NR1 subfamily of nuclear receptor superfamily. The NR1 members regulate transcription that is required in lipid

Immunogen nuclear receptor subfamily 1, group H, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Farnesoid X receptor (FXR/NR1H4) belongs to the nuclear receptor (NR) superfamily. It is a receptor of bile acids (BAs).

Immunogen nuclear receptor subfamily 1, group I, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor subfamily 1, group I, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor subfamily 1, group I, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor subfamily 2, group E, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Mineralocorticoid receptor/nuclear receptor subfamily 3, group C, member 2/ (NR3C2, MLR, MCR) is a nuclear receptor for mineralocorticoids (eg. aldosterone) and glucocorticoids (eg.

Immunogen nuclear receptor subfamily 3, group C, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor subfamily 4, group A, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to nuclear receptor subfamily 4 group A member 1 Sequence PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Synthetic peptide directed towards the middle region of human NR4A3 Application Anti-NR4A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/ml.