-
Add to Cart The item has been addedAMAB90816-100ULSigma-Aldrich
Monoclonal Anti-EGFR antibody produced in mouse (C15-1318-555)
Price: $977.14List Price: $1,085.71Immunogen epidermal growth factor receptor, recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90808-100ULSigma-Aldrich
Monoclonal Anti-NECAB2 antibody produced in mouse (C15-1318-554)
Price: $977.14List Price: $1,085.71Immunogen N-terminal EF-hand calcium binding protein 2, recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90806-100ULSigma-Aldrich
Monoclonal Anti-MMP9 antibody produced in mouse (C15-1318-553)
Price: $977.14List Price: $1,085.71Immunogen matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90805-100ULSigma-Aldrich
Monoclonal Anti-MMP9 antibody produced in mouse (C15-1318-552)
Price: $977.14List Price: $1,085.71Immunogen matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90804-100ULSigma-Aldrich
Monoclonal Anti-MMP9 antibody produced in mouse (C15-1318-551)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase. Sequence -
Add to Cart The item has been addedAMAB90803-100ULSigma-Aldrich
Monoclonal Anti-PGAM5 antibody produced in mouse (C15-1318-550)
Price: $977.14List Price: $1,085.71Immunogen phosphoglycerate mutase family member 5, recombinant protein epitope signature tag (PrEST) Sequence NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV Epitope Binds to an epitope located within the -
Add to Cart The item has been addedAMAB90801-100ULSigma-Aldrich
Monoclonal Anti-NECAB1 antibody produced in mouse (C15-1318-549)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 1. Sequence LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP Epitope Binds to an epitope located within the peptide sequence SIQWPGKRSS as -
Add to Cart The item has been addedAMAB90800-100ULSigma-Aldrich
Monoclonal Anti-NECAB1 antibody produced in mouse (C15-1318-548)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 1. Sequence LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP Epitope Binds to an epitope located within the peptide sequence SIQWPGKRSS as -
Add to Cart The item has been addedAMAB90798-100ULSigma-Aldrich
Monoclonal Anti-NECAB1 antibody produced in mouse (C15-1318-547)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 1. Sequence LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP Epitope Binds to an epitope located within the peptide sequence SIQWPGKRSS as -
Add to Cart The item has been addedAMAB90795-25ULSex determining region Y box 9 (Sox9) is a transcription protein, that belongs to the high-mobility-group box class DNA-binding proteins. It is located on human chromosome 17q24. -
Add to Cart The item has been addedAMAB90795-100ULSigma-Aldrich
Monoclonal Anti-SOX9 antibody produced in mouse (C15-1318-545)
Price: $977.14List Price: $1,085.71Sex determining region Y box 9 (Sox9) is a transcription protein, that belongs to the high-mobility-group box class DNA-binding proteins. It is located on human chromosome 17q24. -
Add to Cart The item has been addedAMAB90792-100ULSigma-Aldrich
Monoclonal Anti-SLC22A2 antibody produced in mouse (C15-1318-544)
Price: $977.14List Price: $1,085.71Immunogen solute carrier family 22 (organic cation transporter), member 2, recombinant protein epitope signature tag (PrEST) Sequence ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR Epitope Binds to an epitope located within the
