-
Add to Cart The item has been addedAMAB90729-100ULSigma-Aldrich
Monoclonal Anti-WWTR1 antibody produced in mouse (C15-1318-519)
Price: $977.14List Price: $1,085.71Immunogen WW domain containing transcription regulator 1 Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry -
Add to Cart The item has been addedAMAB90728-100ULSigma-Aldrich
Monoclonal Anti-MEF2C antibody produced in mouse (C15-1318-518)
Price: $977.14List Price: $1,085.71Immunogen myocyte enhancer factor 2C Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of -
Add to Cart The item has been addedAMAB90727-100ULSigma-Aldrich
Monoclonal Anti-MEF2C antibody produced in mouse (C15-1318-517)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to myocyte enhancer factor 2C. Sequence PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN Epitope Binds to an -
Add to Cart The item has been addedAMAB90725-100ULSigma-Aldrich
Monoclonal Anti-NAPRT antibody produced in mouse (C15-1318-516)
Price: $977.14List Price: $1,085.71Immunogen nicotinate phosphoribosyltransferase Sequence LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV Epitope Binds to an epitope located within the peptide sequence IRKVFRAAAA as determined by -
Add to Cart The item has been addedAMAB90723-100ULSigma-Aldrich
Monoclonal Anti-USP46 antibody produced in mouse (C15-1318-515)
Price: $977.14List Price: $1,085.71Immunogen ubiquitin specific peptidase 46 Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds -
Add to Cart The item has been addedAMAB90722-100ULSigma-Aldrich
Monoclonal Anti-USP46 antibody produced in mouse (C15-1318-514)
Price: $977.14List Price: $1,085.71Immunogen ubiquitin specific peptidase 46 Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds -
Add to Cart The item has been addedAMAB90710-100ULSigma-Aldrich
Monoclonal Anti-P4HA2 antibody produced in mouse (C15-1318-513)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Prolyl 4-hydroxylase, alpha polypeptide II. Sequence LKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGM Epitope Binds to -
Add to Cart The item has been addedAMAB90708-100ULSigma-Aldrich
Monoclonal Anti-SDHB antibody produced in mouse (C15-1318-512)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to succinate dehydrogenase complex, subunit B, iron sulfur (Ip). Sequence EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY Epitope Binds to an -
Add to Cart The item has been addedAMAB90706-25ULImmunogen Recombinant protein corresponding to succinate dehydrogenase complex, subunit B, iron sulfur (Ip). Sequence EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY Epitope Binds to an -
Add to Cart The item has been addedAMAB90706-100ULSigma-Aldrich
Monoclonal Anti-SDHB antibody produced in mouse (C15-1318-510)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to succinate dehydrogenase complex, subunit B, iron sulfur (Ip). Sequence EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY Epitope Binds to an -
Add to Cart The item has been addedAMAB90705-100ULSigma-Aldrich
Monoclonal Anti-SDHB antibody produced in mouse (C15-1318-509)
Price: $977.14List Price: $1,085.71Immunogen succinate dehydrogenase complex, subunit B, iron sulfur (Ip) Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by -
Add to Cart The item has been addedAMAB90704-100ULSigma-Aldrich
Monoclonal Anti-FLT1 antibody produced in mouse (C15-1318-508)
Price: $977.14List Price: $1,085.71Immunogen fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA)
