Sigma-Aldrich

Immunogen Recombinant protein corresponding to SRY (sex determining region Y)-box 11. Sequence FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK Epitope Binds to an epitope located

Immunogen SRY (sex determining region Y)-box 11 recombinant protein epitope signature tag (PrEST) Sequence FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK Epitope Binds to an epitope

Protein A purified mouse monoclonal antibody. Recognizes poly-ADP-ribose.

Protein G purified mouse monoclonal antibody. Recognizes the ~80 kDa TBK1 protein.

Anti-A20 mouse monoclonal antibody, clone 59A426, recognizes ~70 kDa A20 protein in Daudi cells. It is validated for use in immunoblotting and immunoprecipitation.

Apolipoprotein E (Apo E) is a multifunctional protein and exists in 3 isoforms namely apoE2, apoE3, and apoE4. It is the constituent of plasma lipoproteins.

Apolipoprotein C-III (APOC3) is a multifaceted protein, localized on circulating triglyceride-rich lipoproteins (TRLs), high-density lipoprotein (HDL), low-density lipoprotein (LDL), and very-low-density lipoprotein (VLDL). The APOC3 gene is mapped

Product Source: Human plasma, fresh, non-frozen. Tested negative for anti-HIV-1, anti-HIV-2, anti-HCV, anti-HBc and HBsAg.

High Density Lipoprotein (HDL) isolated by sequential isopycnic ultracentrifugation are delipidated. Apo A-II is purified by column chromatography in 6M urea (Schonfeld et al.

High Density Lipoprotein (HDL) isolated by ultracentrifugation are delipidated. Apo A-I is purified by column chromatography in 6M urea (Schonfeld et al.

This Certified Reference Material (CRM) is produced and certified in accordance with ISO 1703 4 and ISO/IEC 17025 . All information regarding the use of this CRM can be found on the certificate of analysis.

This Certified Reference Material (CRM) is produced and certified in accordance with ISO 1703 4 and ISO/IEC 17025 . All information regarding the use of this CRM can be found on the certificate of analysis.