Application
SILu™ MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody has been used to spike peptide samples to assess preparation reproducibility.
Features and Benefits
Universal Peptide Sequence Location
FNWYVDGVEVHNAK Heavy Chain (IgG1)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)
SILu™Mab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
- SILu™Mab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
- Good agreement was observed between multiple peptides derived from the same target.
- Label incorporation was determined to be >98% by mass spectrometry.
- Sequence coverage was confirmed by peptide mapping.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline
Preparation Note
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C<SUB>6</SUB>, 15N<SUB>4</SUB>-labeled Arginine and 13C<SUB>6</SUB>, 15N<SUB>2</SUB>-labeled Lysine.
SILu™Mab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILu™Mab provides univerÂÂsal utility, thus eliminating the need for production of candidate-specific internal standards.
Reconstitution
SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 μL of purified water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.
Analysis Note
SILuMAb K1 Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILuMAb K1 Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Quantitative
MRM settings provided (xls)
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 41116012
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- MSQC6-100UG
- Temperature Control Device:
- Yes