CAYMAN CHEMICAL
AIF Blocking Peptide
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman&rsquos AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman&rsquos AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.
Specifications
- UPC:
- 12352209
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- WeightUOM:
- LB
- MPN:
- 360773-1



