WSHTBIO Dept of Abroad Marketing
-Amyloid Peptide 1-40, 5mg
The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFRHDSGYEVHHQK
The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Specifications
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- WeightUOM:
- LB
- MPN:
- amp40-m5



