General description
ADAM metallopeptidase domain 33 (ADAM33) is a member of the ADAM (a disintegrin and metalloprotease domain) family. ADAM33 is largely expressed in mesenchymal cells including airway fibroblasts, myofibroblasts, and smooth muscle cells.
Immunogen
Synthetic peptide directed towards the middle region of human ADAM33
Application
Anti-ADAM33 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Biochem/physiol Actions
The members of the ADAM (a disintegrin and metalloprotease domain) family are involved in cell-to-cell and cell-to-matrix interactions, neurogenesis and muscle development. The expression of ADAM33 has been linked to asthma and chronic obstructive pulmonary disease (characterised by chronic bronchitis and emphysema). ADAM33 is also associated with inflammation of the lungs which is activated against etiological viral agents.
Sequence
Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49937-100UL