Skip to main content
Exclusive Savings: Take 10% OFF All Cenmed Products | Upgrade Your Lab For Less Shop Now
US English

Sigma-Aldrich

ANTI-DVL2 (C005B-331706)

Immunogen Synthetic peptide directed towards the N terminal region of human DVL2 Biochem/physiol Actions DVL2 is a member of the dishevelled (dsh) protein family. It is a 90-kD protein that undergoes posttranslational phosphorylation to form a

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human DVL2

Biochem/physiol Actions

DVL2 is a member of the dishevelled (dsh) protein family. It is a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Specifications
UPC:
51341805
Condition:
New
Weight:
1.00 Ounces
HazmatClass:
No
Quantity:
1
Unit of Measurement:
EA
MPN:
SAB2100634-100UL
Catalog No. C005B-331706
Price: $1,041.83
List Price: $1,157.59
  • Fast shipping — 3-day lead time
  • Guaranteed quality & reliable delivery
  • Shipping Lead-Time: 3-5 Days
Adding to cart… The item has been added
Request a Quote

Enjoy exclusive benefits, including discounted pricing on bulk orders, by opening a Cenmed Business Account. Learn More.