Skip to main content
Exclusive Savings: Take 10% OFF All Cenmed Products | Upgrade Your Lab For Less Shop Now
US English

Sigma-Aldrich

ANTI-FNTA (C005B-099525)

Farnesyltransferase, CAAX box, α (FNTA) forms a part of the heterodimeric CAAX farnesyltransferase complex that attaches a farnesyl moiety to a cysteine residue in proteins. The protein substrates usually comprise of nuclear lamins, retinal

Description

General description

Farnesyltransferase, CAAX box, α (FNTA) forms a part of the heterodimeric CAAX farnesyltransferase complex that attaches a farnesyl moiety to a cysteine residue in proteins. The protein substrates usually comprise of nuclear lamins, retinal proteins and ras proteins.
Rabbit Anti-FNTA antibody recognizes canine, rat, human, and bovine FNTA.

Immunogen

Synthetic peptide directed towards the C terminal region of human FNTA

Application

Rabbit Anti-FNTA antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein′s with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein′s with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants encoding different isoforms.

Sequence

Synthetic peptide located within the following region: DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Specifications
UPC:
41106607
Condition:
New
Weight:
1.00 Ounces
HazmatClass:
No
Quantity:
100
Unit of Measurement:
UL
MPN:
AV48521-100UL
Catalog No. C005B-099525
Price: $880.17
List Price: $977.96
  • Fast shipping — 3-day lead time
  • Guaranteed quality & reliable delivery
  • Shipping Lead-Time: 3-5 Days
Adding to cart… The item has been added
Request a Quote

Enjoy exclusive benefits, including discounted pricing on bulk orders, by opening a Cenmed Business Account. Learn More.