Sigma-Aldrich
ANTI-FOXO6
Immunogen Synthetic peptide directed towards the N terminal of human FOXO6 Biochem/physiol Actions Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of
Immunogen
Synthetic peptide directed towards the N terminal of human FOXO6
Biochem/physiol Actions
Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which is important in embryonic development. These forkhead transcription factors may play a role in maintenance and survival of developing and adult neurons.
Sequence
Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 41106614
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- MPN:
- SAB2107945-100UL
- Temperature Control Device:
- Yes



