General description
MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
Specificity
Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
Immunogen
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
Application
Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
Physical form
Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.
Other Notes
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Legal Information
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51321708
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- MAB2290
- Temperature Control Device:
- Yes
- Controlled Substances and Cyanide:
- Yes





