Sigma-Aldrich
ANTI-MAGEA3 (C005B-331530)
Immunogen Synthetic peptide directed towards the middle region of human MAGEA3 Biochem/physiol Actions MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other.
Immunogen
Synthetic peptide directed towards the middle region of human MAGEA3
Biochem/physiol Actions
MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Sequence
Synthetic peptide located within the following region: APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51473101
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- MPN:
- SAB2101419-100UL



