Sigma-Aldrich
ANTI-NUCB2 (C005B-098830)
Immunogen Synthetic peptide directed towards the middle region of human NUCB2 Biochem/physiol Actions NUCB2 is an oncoprotein that is overexpressed in breast cancer. This protein binds calcium and is involved in energy homeostasis and eating
Immunogen
Synthetic peptide directed towards the middle region of human NUCB2
Biochem/physiol Actions
NUCB2 is an oncoprotein that is overexpressed in breast cancer. This protein binds calcium and is involved in energy homeostasis and eating regulation in the hypothalamus. It is an important prognostic marker in prostate cancer, promotes osteogenesis and has been identified as anorexigenic and anti-hyperglycemic protein.
Sequence
Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12142207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 100
- Unit of Measurement:
- UL
- MPN:
- AV36567-100UL



