Sigma-Aldrich
ANTI-OXCT2 (C005B-099542)
Immunogen Synthetic peptide directed towards the middle region of human OXCT2 Application Anti-OXCT2 antibody produced in rabbit is suitable for western blotting (1.0μg/ml) of whole cell extracts of human fibroblasts.
Immunogen
Synthetic peptide directed towards the middle region of human OXCT2
Application
Anti-OXCT2 antibody produced in rabbit is suitable for western blotting (1.0μg/ml) of whole cell extracts of human fibroblasts.
Biochem/physiol Actions
OXCT2 (3-oxoacid CoA transferase 2) is a testis-specific enzyme that catalyzes the reversible transfer of 3-oxoacid CoA transferase 2 in the ketone utilization pathway.
Sequence
Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51203604
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 100
- Unit of Measurement:
- UL
- MPN:
- AV48886-100UL



