Sigma-Aldrich
ANTI-RBPJL
RBPJL (SUHL or RBPSUHL) is the human homolog of Drosophila Suppressor of Hairless. Mouse Rbpj functions as a transcription factor and modulates the Notch signaling pathway to maintain neural progenitors.
General description
RBPJL (SUHL or RBPSUHL) is the human homolog of Drosophila Suppressor of Hairless. Mouse Rbpj functions as a transcription factor and modulates the Notch signaling pathway to maintain neural progenitors. It complexes with Ptf1a to regulate the specification of GABAergic neurons in mouse neural tubes.
Rabbit Anti-RBPJL antibody recognizes bovine, human, mouse, and rat RBPJL.
Immunogen
Synthetic peptide directed towards the N terminal region of human RBPJL
Application
Rabbit Anti-RBPJL can be used for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPSUHL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). The protein encoded by this gene is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
Sequence
Synthetic peptide located within the following region: AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYIS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41106514
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 100
- Unit of Measurement:
- UL
- MPN:
- AV34313-100UL



