Skip to main content
Exclusive Savings: Take 10% OFF All Cenmed Products | Upgrade Your Lab For Less Shop Now
US English

Sigma-Aldrich

ANTI-SDF2 (C005B-099531)

SDF2 codes for stromal cell-derived factor 2 that functions as a secretory protein. Studies in Arabidopsis have revealed that SDF2 regulates unfolded protein response in the endoplasmic reticulum.

Description

General description

SDF2 codes for stromal cell-derived factor 2 that functions as a secretory protein. Studies in Arabidopsis have revealed that SDF2 regulates unfolded protein response in the endoplasmic reticulum.
Rabbit Anti-SDF2 antibody recognizes bovine, human, mouse, rat, and zebrafish SDF2.

Immunogen

Synthetic peptide directed towards the N terminal region of human SDF2

Application

Rabbit Anti-SDF2 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.

Biochem/physiol Actions

SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Sequence

Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Specifications
UPC:
41116134
Condition:
New
Weight:
1.00 Ounces
HazmatClass:
No
MPN:
AV48718-100UL
Catalog No. C005B-099531
Price: $825.16
List Price: $916.84
  • Fast shipping — 3-day lead time
  • Guaranteed quality & reliable delivery
  • Shipping Lead-Time: 3-5 Days
Adding to cart… The item has been added
Request a Quote

Enjoy exclusive benefits, including discounted pricing on bulk orders, by opening a Cenmed Business Account. Learn More.