Sigma-Aldrich
ANTI-TFAM ANTIBODY PRODUCED IN MOUSE
General description This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene
General description
This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. (provided by RefSeq)
Transcription factor A, mitochondrial (TFAM) is encoded by the gene mapped to human chromosome 10q21.1. The gene codes for a DNA binding protein characterized with HMG (high mobility group)-box domains.
Immunogen
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Biochem/physiol Actions
Transcription factor A, mitochondrial (TFAM) plays a vital role in transcription and replication of mammalian mitochondrial DNA (mtDNA). In addition, it is also implicated in mtDNA packaging. Polymorphism in the gene increases the risk of susceptibility to Alzheimer disease (AD). Additionally, mutation in the gene is associated with the development of mtDNA depletion syndrome.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51431806
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- MPN:
- SAB1401382-50UG
- Temperature Control Device:
- Yes
- Controlled Substances and Cyanide:
- Yes



