Skip to main content
Exclusive Savings: Take 10% OFF All Cenmed Products | Upgrade Your Lab For Less Shop Now
US English

Sigma-Aldrich

ANTI-TLR9

Immunogen Synthetic peptide directed towards the N terminal region of human TLR9 Biochem/physiol Actions TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human TLR9

Biochem/physiol Actions

TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Specifications
UPC:
51281638
Condition:
New
Weight:
1.00 Ounces
HazmatClass:
No
Quantity:
1
Unit of Measurement:
EA
MPN:
SAB2104136-100UL
Catalog No. C005B-331043
Price: $1,041.83
List Price: $1,157.59
  • Fast shipping — 3-day lead time
  • Guaranteed quality & reliable delivery
  • Shipping Lead-Time: 3-5 Days
Adding to cart… The item has been added
Request a Quote

Enjoy exclusive benefits, including discounted pricing on bulk orders, by opening a Cenmed Business Account. Learn More.