Immunogen
Synthetic peptide directed towards the C terminal region of human TOR1B
Application
Anti-TOR1B antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Biochem/physiol Actions
TOR1B [Torsin family 1, member B (torsin B)] gene encodes a 336 amino acid containing protein, predominantly expressed in the developing human brain and belonging to ClpA/ClpB family and torsin subfamily. It plays a pivotal role in postnatal developmental events and is crucial for proper neurological development. TOR1B may also facilitate as a molecular chaperone assisting in the proper folding of secreted and membrane proteins. Mutation in TOR1B gene results in torsion dystonia, an autosomal dominant neurological disorder.
Sequence
Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51313100
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV47036-100UL