Sigma-Aldrich
ANTI-TTC19 (C005B-098871)
TTC19 contains a tetratricopeptide repeat (TPR) domain that is believed to be involved in protein-protein interactions. Mutations in TTC19 have recently been shown to cause mitochondrial complex III deficiency and neurological impairment in humans.
General description
TTC19 contains a tetratricopeptide repeat (TPR) domain that is believed to be involved in protein-protein interactions. Mutations in TTC19 have recently been shown to cause mitochondrial complex III deficiency and neurological impairment in humans. The exact function of this protein is unknown.
Immunogen
Synthetic peptide directed towards the N terminal region of mouse TTC19
Biochem/physiol Actions
TTC19′s fucntion is not fully determined yet.
Sequence
Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12142207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 100
- Unit of Measurement:
- UL
- MPN:
- AV37392-100UL
- Controlled Substances and Cyanide:
- Yes



