Peptide Synthesis

Acid-PEG25-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG3-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG5-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG5-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG5-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG9-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG9-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Acid-PEG9-NHS ester is a PEG derivative containing a carboxylic acid and an NHS ester. The hydrophilic PEG spacer increases solubility in aqueous media. The terminal carboxylic acid can be reacted with primary amine groups in the presence of

Immunogen 15 amino acids near the amino terminus of human adiponectin. Application Used as a blocking peptide in immunoblotting applications.

Immunogen 16 amino acids near the carboxy terminus of human AES. Application Used as a blocking peptide in immunoblotting applications.

Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman&rsquos AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.

Immunogen 16 amino acids near the amino terminus of human AIM. Application Used as a blocking peptide in immunoblotting applications.