Bone Morphogenetic Protein-2; Human BMP-2, 2ug

BMP-2, Bone Morphogenetic Protein-2, human: Human Bone Morphogenetic Protein 2 (BMP-2) BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis and is expressed in a variety of tissues including lung, spleen, brain, liver, prostate ovary, and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease.  Source: Escherichia coli. Molecular Weight: Approximately 26 kDa, a homodimeric protein consisting of two 115 amino acid non-glycosylated polypeptide chains. Quantity: 2ug/10ug/1mg Purity: >95% by SDS-PAGE and HPLC analyses. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of MC3T3-E1 cells is less than 50 ng/ml. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized from a 0.2mm filtered concentrated (1mg/ml) solution containing 10mM sodium citrate pH 3.5.  AA Sequence: MQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP F PLADHLNSTN HAIVQTLVNS VNSKIPKACC VPTELSAISM LYLDENEKVV LKNYQDMVVE GCGCR Endotoxin: Less than 1EU/mg of rHuBMP-2 as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

UPC:

51182423

Condition:

New

Weight:

1.00 Ounces

HazmatClass:

No

WeightUOM:

LB

MPN:

RC219-13.SIZE.2ug