Cell Biology

Immunogen CD22 molecule recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen CD226 antigen precursor recombinant protein epitope signature tag (PrEST) Application Anti-CD226 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen CD226 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to CD226 molecule Sequence EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Recombinant protein corresponding to CD24 molecule Sequence TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Specificity The antibody reacts with the CD24 antigen a heavily glycosylated molecule that migrates as a broad band of 35-45 kDa on both reducing and non-reducing SDS gel electrophoresis. CD24 is attached to the cell membrane via a glycosyl

CD247 (cluster of differentiation 247), also known as T-cell receptor T3 zeta chain (CD3&#958), forms a part of the TCR (T-cell receptor)-CD3 complex. This gene is localized to human chromosome 1q22-q23 and is composed of eight exons.

Immunogen CD248 molecule, endosialin recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunofluorescence (1

CD27, a member of tumour necrosis factor receptor superfamily is mainly responsible for regulation of cell proliferation and cell death. CD27 and its ligand CD70 expresses mainly on lymphocytes.

Immunogen CD27 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

CD276 (cluster of differentiation 276) is a member of the B7 family of T cell co-regulatory molecules, which functions as an immune-regulatory molecule. This protein is inducible by inflammatory cytokines on T-cells, B-cells and dendritic cells.

CD276 is a costimulatory molecule belonging to the B7 family. It is expressed in various normal tissues and in several tumor cell lines.