-
Add to Cart The item has been added86052101-1VLCLONE 707MOUSE DBA/2 FRIEND LEUKAEMIC LYMPHOBLAS (C15-1310-958)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Mouse DBA/2 Friend leukaemic lymphoblast Cell Line Description Produced by infecting a DBA/2 mouse with Friend leukaemia virus. Inducible haemoglobin synthesis by exposure to DMSO (reversible action) may represent the -
Add to Cart The item has been added89051705-1VLCLONE C6/36MOSQUITO LARVAE AEDES ALBOPICTUS (C15-1311-408)
Price: $1,407.43List Price: $1,563.81Cell Line Origin Mosquito larvae, Aedes albopictus Cell Line Description Derived from Aedes albopictus cells. Useful for propagation of Dengue virus and flaviviruses. -
Add to Cart The item has been added86082105-1VLCMT64/61 MOUSE C57BL/1CRF LUNG CARCINOM (C15-1310-984)
Price: $1,181.14List Price: $1,312.38Cell Line Origin Mouse C57BL/1CRF lung carcinoma Cell Line Description Derived from an alveologenic lung carcinoma from a C57BL/1CRF mouse. Can be maintained in a completely defined serum free medium, but the growth rate is much slower than in -
Add to Cart The item has been added10112001-1VLCOCA CELL LINE FROM MOUSE
Price: $1,630.29List Price: $1,811.43Cell Line Origin Mouse epidermal keratinocyes, differentiation Cell Line Description COCA, a murine epidermal cell line was developed by serially passaging keratinocytes from the back skin of adult C57BL/DBA mice. Culture of the COCA cells is in -
-
Add to Cart The item has been addedC8490-10UGCRG-2 from mouse
Price: $1,065.09List Price: $1,183.43Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. -
Add to Cart The item has been added88031605-1VLCRI-D2 RAT NEDH ISLET TUMOUR (C15-1311-246)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Rat NEDH islet tumour Cell Line Description Established from a NEDH rat transplantable islet cell tumour. The cells secrete insulin and glucagon. -
Add to Cart The item has been added87052701-1VLCRI-G1 RAT NEDH ISLET TUMOUR (C15-1311-139)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Rat NEDH islet tumour Cell Line Description Established from a NEDH rat transplantable islet cell tumour. The cells secrete insulin and glucagon. -
Add to Cart The item has been added88031603-1VLCRI-G5 RAT NEDH ISLET TUMOUR (C15-1311-244)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Rat NEDH islet tumour Cell Line Description Established from a NEDH rat transplantable islet cell tumour. The cells secrete insulin and glucagon. -
Add to Cart The item has been added93042610-1VLCTLL-2 MOUSE C57B1/6 T CELL (C15-1313-533)
Price: $1,181.14List Price: $1,312.38Cell Line Origin Mouse C57b1/6 T cell Cell Line Description CTLL is a subclone of T cells derived from a C57bl/6 mouse. The cells require IL-2 for growth and are used to assay for its presence in conditioned media. -
Add to Cart The item has been addedZ03249-50DCIP-1/CXCL3, Mouse, 50ug
Price: $318.97List Price: $354.41Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its -
Add to Cart The item has been added90070551-1VLDH14 DROSOPHILA EMBRYO (C15-1311-764)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Drosophila embryo Cell Line Description Derived from Drosophila embryo, can support the growth of picornaviruses and rhabdoviruses. Application Virus studies Culture Medium Schneider′s Insect Medium + 10% Foetal Bovine Serum
